PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30174.m008828
Common NameRCOM_1610560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 733aa    MW: 80414.8 Da    PI: 6.059
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30174.m008828genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS319.66.5e-983777324374
           GRAS   4 lLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                     + ++Ae +++g+ +laq +Larl+++ + + g+p +R+a+yf+eAL+  l+       ++ +ps+ s+ n + ++ a+k fse+sPil+fs++t+
  30174.m008828 377 PICQAAELIETGNPALAQGILARLNHQlSLSIGKPHTRAAFYFKEALQLLLHM-----NNTANPSSLSPCNLILKIGAYKSFSEISPILQFSNFTC 467
                    5789**********************9455667****************9997.....8888999999999************************* PP

           GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee. 193
                    Nqa+lea eg++r+Hi+Dfdi+ G+QW++L+q+La R++g  sl+iT+++sp+ +++ el  t+e+L+ fA e+++pfe ++l  ++l++ + ++ 
  30174.m008828 468 NQALLEACEGSDRIHIVDFDIGFGGQWASLMQELALRNGGVSSLKITAFVSPS-HDEIELGFTQENLRVFAGEINMPFELEILGLDALNSGSWSMp 562
                    ***************************************************76.7999************************98888888776655 PP

           GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                    +r++ +E++aVnl ++ ++ +  + s     + vL++vk+lsPk+vv  ++ +d+++ +F++++ ++++ ys l++slea    + ++ +k+Er+l
  30174.m008828 563 IRISDKEVIAVNLPIAPFSNY--PSS----LPVVLRFVKQLSPKIVVSLDRGCDRTDLPFAHHINHSIQSYSGLLESLEAV-NMNIDALQKIERFL 651
                    89999**********888887..444....456*********************************************776.4567999******* PP

           GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    ++++i+++v  ++ +      +   W++ + ++GF+p ++s++a++qa++l+++++++g++ve+++ +lvl+W++++L+s+SaWr
  30174.m008828 652 VQPAIEKIVLSRHGH----PDRTTPWKSLFLQSGFTPFQFSNFAESQAECLVQRTPVRGFHVEKRQSTLVLCWQRKELISASAWR 732
                    **********99998....88889************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.422348712IPR005202Transcription factor GRAS
PfamPF035142.2E-95377732IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MPLAFEDFQG KGVLDFSSSS TSSPDSLHQL LLPPQSQHRQ QKWQNSNPKE ICCYVGSEPT  60
SVLDARRSPS PPTSSSTLSS SQGGSNSAAG GGGRGTSIET TTTTGVAAAA VSGNLSVDTS  120
TEKCGQQQLG MEDWEGVLPG SPSQEQEQEQ SILRLIMGDI EDPSLGLNKL LQDGSGSHDT  180
EFNAGFGVVD QGFGFEPMNG ANLVNSIDPI SSAFPLLSHN ARIGSVLNQT QDPNPATTST  240
GNNLLSGMFQ HQPAIEAREE KPQIFNPQVI INQNQAHFSQ NQAMFLPLSY AQLQEHHHLL  300
SPPPPKRLNS GPVGANNFQV QKLPFPDSRP ELFLQRQQQQ QHQLQMLQQQ QRPAIMKQKI  360
MTDELAAQQL QQAIINPICQ AAELIETGNP ALAQGILARL NHQLSLSIGK PHTRAAFYFK  420
EALQLLLHMN NTANPSSLSP CNLILKIGAY KSFSEISPIL QFSNFTCNQA LLEACEGSDR  480
IHIVDFDIGF GGQWASLMQE LALRNGGVSS LKITAFVSPS HDEIELGFTQ ENLRVFAGEI  540
NMPFELEILG LDALNSGSWS MPIRISDKEV IAVNLPIAPF SNYPSSLPVV LRFVKQLSPK  600
IVVSLDRGCD RTDLPFAHHI NHSIQSYSGL LESLEAVNMN IDALQKIERF LVQPAIEKIV  660
LSRHGHPDRT TPWKSLFLQS GFTPFQFSNF AESQAECLVQ RTPVRGFHVE KRQSTLVLCW  720
QRKELISASA WRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3238973218375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511661.20.0PREDICTED: scarecrow-like protein 6
TrEMBLB9RD720.0B9RD72_RICCO; Putative uncharacterized protein
STRINGPOPTR_0002s14550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-143GRAS family protein